PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400015928
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family WRKY
Protein Properties Length: 318aa    MW: 35879.1 Da    PI: 6.5051
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400015928genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.98.6e-33168225259
                           --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           +Dgy+WrKYGqK vk+s+fpr+YYrCt a+C+vkk+ver+ +dp++v++tYeg+H+h+
  PGSC0003DMP400015928 168 EDGYRWRKYGQKAVKNSPFPRNYYRCTNATCNVKKRVERCFSDPSIVVTTYEGKHTHP 225
                           8********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381301.0E-991315IPR017396PWRKY transcription factor, group IIc
Gene3DG3DSA:2.20.25.807.4E-35152227IPR003657WRKY domain
SuperFamilySSF1182903.27E-29159227IPR003657WRKY domain
PROSITE profilePS5081131.582162227IPR003657WRKY domain
SMARTSM007742.7E-39167226IPR003657WRKY domain
PfamPF031061.2E-25168225IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0009733Biological Processresponse to auxin
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MESYKDIKME DHHPMYFIDN NNFGVTNHSL ISDYNINTSS LGFMELLGFH QDFYSSASAF  60
ELPKEENYCP AVCVSEEEEV KPSSVVPENQ IISSTTVATG NVLNTPSTPN CSSISSEGHG  120
DADGEVENHE QQNTKTKQQL KAKKTVSQKK QKEPRFAFMT KSEVDFLEDG YRWRKYGQKA  180
VKNSPFPRNY YRCTNATCNV KKRVERCFSD PSIVVTTYEG KHTHPSPMNM MMSRPNCYPI  240
NPLLPSPGTF TLPMQFNINQ SFNNLTSSNL AMNNQLDHAA FAAQGRRFCS NTEMLGDQGI  300
DLQDLMPSAV LKHEYNR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-271602271077Probable WRKY transcription factor 4
2lex_A2e-271602271077Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00069PBMTransfer from AT2G47260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU0569160.0EU056916.1 Solanum tuberosum WRKY transcription factor 4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001275158.10.0WRKY transcription factor 4
SwissprotO229004e-51WRK23_ARATH; Probable WRKY transcription factor 23
TrEMBLM1AI800.0M1AI80_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000233680.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13092479
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47260.13e-40WRKY DNA-binding protein 23
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]